Cyclin B1 Rabbit pAb, Unconjugated

Produktübersicht

• Artikelname: Cyclin B1 Rabbit pAb, Unconjugated
• Artikelnummer: ABB-A16038
• Hersteller Artikelnummer: A16038
• Alternativnummer: ABB-A16038-100UL,ABB-A16038-20UL,ABB-A16038-1000UL,ABB-A16038-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CCNB, Cyclin B1

Produktbeschreibung

The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). The encoded protein is necessary for proper control of the G2/M transition phase of the cell cycle.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 48kDa
• NCBI: 891
• UniProt: P14635
• Reinheit: Affinity purification
• Sequenz: YDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
• Target-Kategorie: CCNB1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Cancer,ATM Signaling Pathway,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cell Cycle Control-G2 M DNA Damage Checkpoint,Endocrine Metabolism,AMPK Signaling Pathway.

Bilder

Immunohistochemistry analysis of paraffin-embedded Rat testis using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human lung cancer using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western blot analysis of various lysates using Cyclin B1 Rabbit pAb (A16038) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Immunohistochemistry analysis of paraffin-embedded Human breast cancer using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunofluorescence analysis of HeLa cells using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunoprecipitation analysis of 200 µg extracts of HeLa cells, using 3 µg Cyclin B1 antibody (A16038). Western blot was performed from the immunoprecipitate using Cyclin B1 antibody (A16038) at a dilution of 1:1000.