Cyclin B1 Rabbit pAb, Unconjugated

Product Overview

• Article Name: Cyclin B1 Rabbit pAb, Unconjugated
• Biozol Catalog Number: ABB-A16038
• Supplier Catalog Number: A16038
• Alternative Catalog Number: ABB-A16038-100UL,ABB-A16038-20UL,ABB-A16038-1000UL,ABB-A16038-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, IP, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CCNB, Cyclin B1

Product Description

The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). The encoded protein is necessary for proper control of the G2/M transition phase of the cell cycle.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 48kDa
• NCBI: 891
• UniProt: P14635
• Purity: Affinity purification
• Sequence: YDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
• Target: CCNB1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Cancer,ATM Signaling Pathway,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cell Cycle Control-G2 M DNA Damage Checkpoint,Endocrine Metabolism,AMPK Signaling Pathway.

Images

Immunohistochemistry analysis of paraffin-embedded Rat testis using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human lung cancer using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western blot analysis of various lysates using Cyclin B1 Rabbit pAb (A16038) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Immunohistochemistry analysis of paraffin-embedded Human breast cancer using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunofluorescence analysis of HeLa cells using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of PC-12 cells using Cyclin B1 Rabbit pAb (A16038) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunoprecipitation analysis of 200 µg extracts of HeLa cells, using 3 µg Cyclin B1 antibody (A16038). Western blot was performed from the immunoprecipitate using Cyclin B1 antibody (A16038) at a dilution of 1:1000.