[KD Validated] CDX2 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: [KD Validated] CDX2 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A19030
• Hersteller Artikelnummer: A19030
• Alternativnummer: ABB-A19030-100UL,ABB-A19030-20UL,ABB-A19030-1000UL,ABB-A19030-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: CDX3, CDX-3, CDX2/AS, X2

Produktbeschreibung

This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded protein is a major regulator of intestine-specific genes involved in cell growth an differentiation. This protein also plays a role in early embryonic development of the intestinal tract. Aberrant expression of this gene is associated with intestinal inflammation and tumorigenesis.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC0450]
• Molekulargewicht: 34kDa
• NCBI: 1045
• UniProt: Q99626
• Reinheit: Affinity purification
• Sequenz: MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGS
• Target-Kategorie: CDX2
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000|IP,0.5µg-4µg antibody for 200µg-600µg extracts of whole cells|IF-P,1:100 - 1:1000|IHC-P,1:3000 - 1:12000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Stem Cells.

Bilder

Western blot analysis of lysates from wild type(WT) and CDX2 knockdown (KD) 293T cells, using [KD Validated] CDX2 Rabbit mAb (A19030) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Immunohistochemistry analysis of paraffin-embedded Human colon tissue using [KD Validated] CDX2 Rabbit mAb (A19030) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Western blot analysis of various lysates using [KD Validated] CDX2 Rabbit mAb (A19030) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using [KD Validated] CDX2 Rabbit mAb (A19030) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using [KD Validated] CDX2 Rabbit mAb (A19030) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat colon tissue using [KD Validated] CDX2 Rabbit mAb (A19030) at a dilution of 1:4000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Confocal imaging of Human colon using [KD Validated] CDX2 Rabbit mAb (A19030,dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 40x.

Immunoprecipitation analysis of 600 µg extracts of 293T cells using 3 µg [KD Validated] CDX2 Rabbit mAb (A19030). Western blot was performed from the immunoprecipitate using CDX2 antibody (A19030) at a dilution of 1:500.

Immunoprecipitation analysis of 600 µg extracts of 293T cells using 3 µg [KD Validated] CDX2 Rabbit mAb (A19030). Western blot was performed from the immunoprecipitate using CDX2 antibody (A19030) at a dilution of 1:500.