[KD Validated] METTL3 Rabbit mAb, Unconjugated

Artikelnummer: ABB-A19079
Artikelname: [KD Validated] METTL3 Rabbit mAb, Unconjugated
Artikelnummer: ABB-A19079
Hersteller Artikelnummer: A19079
Alternativnummer: ABB-A19079-100UL,ABB-A19079-20UL,ABB-A19079-1000UL,ABB-A19079-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: M6A, IME4, Spo8, MT-A70, hMETTL3, METTL3
This gene encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0487]
Molekulargewicht: 64kDa
NCBI: 56339
UniProt: Q86U44
Reinheit: Affinity purification
Sequenz: SDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDSPVPTAPTSGGPKPSTASAVPELATDPELEKKLLHHLSDLALTLPTDAVSICLAISTPDAPATQDGVESLLQKFAAQELIEVKRGLLQDDAHPTLVTYADHSKLSAMMGAVAEKKGPGEVAGTVTGQKRRAEQDSTTVAAFASSLVSGLNSSASEPAKEPAKKSRKHAASDVDLEIESLLNQQSTKEQQSKKVSQEILELL
Target-Kategorie: METTL3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:2000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|IF/ICC,1:100 - 1:400|IHC-P,1:200 - 1:800|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Epigenetics Nuclear Signaling.
Western blot analysis of lysates from HeLa cells using [KD Validated] METTL3 Rabbit mAb (A19079) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
Western blot analysis of lysates from Rat brain using [KD Validated] METTL3 Rabbit mAb (A19079) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of lysates from wild type (WT) and METTL3 knockdown (KD) 293T cells using METTL3 Rabbit mAb (A19079) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.
Western blot analysis of lysates from Mouse brain using [KD Validated] METTL3 Rabbit mAb (A19079) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using [KD Validated] METTL3 Rabbit mAb (A19079) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human tonsil tissue using [KD Validated] METTL3 Rabbit mAb (A19079) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat spleen tissue using [KD Validated] METTL3 Rabbit mAb (A19079) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Confocal imaging of HeLa cells using [KD Validated] METTL3 Rabbit mAb (A19079,dilution 1:100)(Red) followed by a further incubation with Cy3-conjugated Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with alpha-Tubulin mAb (AC012, dilution 1:400) followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Immunoprecipitation of METTL3 from 200 µg extracts of 293F cells was performed using 0.5 µg of [KD Validated] METTL3 Rabbit mAb (A19079). Rabbit IgG isotype control(AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1x reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using [KD Validated] METTL3 Rabbit mAb (A19079) at a dilution of 1:500.