[KO Validated] N-Cadherin Rabbit mAb, Unconjugated

Artikelnummer: ABB-A19083
Artikelname: [KO Validated] N-Cadherin Rabbit mAb, Unconjugated
Artikelnummer: ABB-A19083
Hersteller Artikelnummer: A19083
Alternativnummer: ABB-A19083-20UL,ABB-A19083-100UL,ABB-A19083-500UL,ABB-A19083-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CDHN, NCAD, ACOGS, ADHD8, CD325, ARVD14, CDw325, in
This gene encodes a classical cadherin and member of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein is proteolytically processed to generate a calcium-dependent cell adhesion molecule and glycoprotein. This protein plays a role in the establishment of left-right asymmetry, development of the nervous system and the formation of cartilage and bone.
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0371]
Molekulargewicht: 100 kDa
NCBI: 1000
UniProt: P19022
Reinheit: Affinity purification
Sequenz: AKFLIYAQDKETQEKWQVAVKLSLKPTLTEESVKESAEVEEIVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGP
Target-Kategorie: CDH2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:2000|IF-P,1:50 - 1:200|IHC-P,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cell Adhesion,Cadherins,Tight Junctions,Cytoskeleton,Wnt -Catenin Signaling Pathway,Immunology Inflammation,CDs,Stem Cells,Hematopoietic Progenitors.
Western blot analysis of lysates from C2C12 cells using [KO Validated] N-Cadherin Rabbit mAb (A19083) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of lysates from C6 cells using [KO Validated] N-Cadherin Rabbit mAb (A19083) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of lysates from wild type (WT) and N-Cadherin knockout (KO) HeLa cells using [KO Validated] N-Cadherin Rabbit mAb (A19083) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.
Immunohistochemistry analysis of paraffin-embedded Human liver tissue using [KO Validated] N-Cadherin Rabbit mAb (A19083) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KO Validated] N-Cadherin Rabbit mAb (A19083) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using [KO Validated] N-Cadherin Rabbit mAb (A19083) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using [KO Validated] N-Cadherin Rabbit mAb (A19083) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
Confocal imaging of paraffin-embedded rat heart using [KO Validated] N-Cadherin Rabbit mAb (A19083, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining.
Confocal imaging of paraffin-embedded Mouse heart using [KO Validated] N-Cadherin Rabbit mAb (A19083, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining.