[KO Validated] N-Cadherin Rabbit mAb, Unconjugated

Product Overview

• Article Name: [KO Validated] N-Cadherin Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A19083
• Supplier Catalog Number: A19083
• Alternative Catalog Number: ABB-A19083-20UL,ABB-A19083-100UL,ABB-A19083-500UL,ABB-A19083-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: CDHN, NCAD, ACOGS, ADHD8, CD325, ARVD14, CDw325, in

Product Description

This gene encodes a classical cadherin and member of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein is proteolytically processed to generate a calcium-dependent cell adhesion molecule and glycoprotein. This protein plays a role in the establishment of left-right asymmetry, development of the nervous system and the formation of cartilage and bone.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ARC0371]
• Molecular Weight: 100 kDa
• NCBI: 1000
• UniProt: P19022
• Purity: Affinity purification
• Sequence: AKFLIYAQDKETQEKWQVAVKLSLKPTLTEESVKESAEVEEIVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGP
• Target: CDH2
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:2000|IF-P,1:50 - 1:200|IHC-P,1:1000 - 1:4000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse,Rat, ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cell Adhesion,Cadherins,Tight Junctions,Cytoskeleton,Wnt -Catenin Signaling Pathway,Immunology Inflammation,CDs,Stem Cells,Hematopoietic Progenitors.

Images

Western blot analysis of lysates from C2C12 cells using [KO Validated] N-Cadherin Rabbit mAb (A19083) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Western blot analysis of lysates from C6 cells using [KO Validated] N-Cadherin Rabbit mAb (A19083) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of lysates from wild type (WT) and N-Cadherin knockout (KO) HeLa cells using [KO Validated] N-Cadherin Rabbit mAb (A19083) at 1:1000 dilution incubated overnight at 4°C.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1min.

Immunohistochemistry analysis of paraffin-embedded Human liver tissue using [KO Validated] N-Cadherin Rabbit mAb (A19083) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using [KO Validated] N-Cadherin Rabbit mAb (A19083) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using [KO Validated] N-Cadherin Rabbit mAb (A19083) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using [KO Validated] N-Cadherin Rabbit mAb (A19083) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Confocal imaging of paraffin-embedded rat heart using [KO Validated] N-Cadherin Rabbit mAb (A19083, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining.

Confocal imaging of paraffin-embedded Mouse heart using [KO Validated] N-Cadherin Rabbit mAb (A19083, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. High pressure antigen retrieval performed with 0.01M Citrate Buffer(pH 6.0) prior to IF staining.