SARS-CoV-2 Spike S1 Rabbit pAb

Produktübersicht

• Artikelname: SARS-CoV-2 Spike S1 Rabbit pAb
• Artikelnummer: ABB-A20136
• Hersteller Artikelnummer: A20136
• Alternativnummer: ABB-A20136-20UL,ABB-A20136-100UL,ABB-A20136-1000UL,ABB-A20136-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IP, WB
• Spezies Reaktivität: Human, Virus
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Alternative Synonym: sars-cov-2, spike glycoprotein, SARS-CoV-2 Spike S1

Produktbeschreibung

Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ The structural proteins of SARS-CoV-2 include the envelope protein (E), spike or surface glycoprotein (S), membrane protein (M) and the nucleocapsid protein (N). The spike glycoprotein is found on the outside of the virus particle and gives coronavirus viruses their crown-like appearance. This glycoprotein mediates attachment of the virus particle and entry into the host cell. S protein is an important target for vaccine development, antibody therapies and diagnostic antigen-based tests.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 141kDa
• NCBI: 43740568
• UniProt: P0DTC2
• Reinheit: Affinity purification
• Sequenz: VSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAY
• Target-Kategorie: Spike S1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IF/ICC,1:100 - 1:500|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,1:20000-1:80000
• Anwendungsbeschreibung: Cross-Reactivity: Human,SARS-CoV-2

Bilder

Immunofluorescence analysis of 293T cells transfected with SARS-CoV-2 Spike S1 fusion protein (top left) and untreated 293T cells (top right) use SARS-CoV-2 Spike S1 Rabbit pAb (A20136) at dilution of 1:400 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunoprecipitation analysis of 300 µg extracts of 293T cells using 3 µg SARS-CoV-2 Spike S1 antibody (A20136). Western blot was performed from the immunoprecipitate using SARS-CoV-2 Spike S1 antibody (A20136) at a dilution of 1:10000.

Western blot analysis of lysates from 293T cells, using SARS-CoV-2 Spike S1 Rabbit pAb (A20136) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Immobilized Recombinant SARS-COV-2 Spike S1 Protein (RP01262LQ) at 1µg/mL (100µL/well) can bind SARS-CoV-2 Spike S1 Rabbit pAb (A20136) with a linear range of 0.78-50ng/mL.