SARS-CoV-2 Spike S1 Rabbit pAb, Polyclonal

Catalog Number: ABB-A20136
Article Name: SARS-CoV-2 Spike S1 Rabbit pAb, Polyclonal
Biozol Catalog Number: ABB-A20136
Supplier Catalog Number: A20136
Alternative Catalog Number: ABB-A20136-20UL,ABB-A20136-100UL,ABB-A20136-1000UL,ABB-A20136-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IP, WB
Species Reactivity: Human, Virus
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Names: sars-cov-2, spike glycoprotein, SARS-CoV-2 Spike S1
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ The structural proteins of SARS-CoV-2 include the envelope protein (E), spike or surface glycoprotein (S), membrane protein (M) and the nucleocapsid protein (N). The spike glycoprotein is found on the outside of the virus particle and gives coronavirus viruses their crown-like appearance. This glycoprotein mediates attachment of the virus particle and entry into the host cell. S protein is an important target for vaccine development, antibody therapies and diagnostic antigen-based tests.
Clonality: Polyclonal
Molecular Weight: 141kDa
NCBI: 43740568
UniProt: P0DTC2
Purity: Affinity purification
Sequence: VSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAY
Target: Spike S1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|IF/ICC,1:100 - 1:500|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,1:20000-1:80000
Application Notes: Cross-Reactivity: Human,SARS-CoV-2. Shipping: Ice Bag
Immunofluorescence analysis of 293T cells transfected with SARS-CoV-2 Spike S1 fusion protein (top left) and untreated 293T cells (top right) use SARS-CoV-2 Spike S1 Rabbit pAb (A20136) at dilution of 1:400 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300 µg extracts of 293T cells using 3 µg SARS-CoV-2 Spike S1 antibody (A20136). Western blot was performed from the immunoprecipitate using SARS-CoV-2 Spike S1 antibody (A20136) at a dilution of 1:10000.
Western blot analysis of lysates from 293T cells, using SARS-CoV-2 Spike S1 Rabbit pAb (A20136) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immobilized Recombinant SARS-COV-2 Spike S1 Protein (RP01262LQ) at 1µg/mL (100µL/well) can bind SARS-CoV-2 Spike S1 Rabbit pAb (A20136) with a linear range of 0.78-50ng/mL.