SARS-CoV-2 ORF7a Rabbit pAb, Unconjugated

Artikelnummer: ABB-A20307
Artikelname: SARS-CoV-2 ORF7a Rabbit pAb, Unconjugated
Artikelnummer: ABB-A20307
Hersteller Artikelnummer: A20307
Alternativnummer: ABB-A20307-100UL,ABB-A20307-20UL,ABB-A20307-1000UL,ABB-A20307-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Virus
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: sars-cov-2
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF7a encodes a viral accessory protein. Based on its similarity to other coronavirus proteins, ORF7a protein is thought to be a type I transmembrane protein.
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 43740573
UniProt: P0DTC7
Reinheit: Affinity purification
Sequenz: ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYS
Target-Kategorie: ORF7a
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: SARS-CoV-2
Western blot analysis of extracts of normal 293T cells and 293T transfected with ORF7a Protein, using SARS-CoV-2 ORF7a Rabbit pAb (A20307) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.