SARS-CoV-2 ORF7a Rabbit pAb, Unconjugated

Catalog Number: ABB-A20307
Article Name: SARS-CoV-2 ORF7a Rabbit pAb, Unconjugated
Biozol Catalog Number: ABB-A20307
Supplier Catalog Number: A20307
Alternative Catalog Number: ABB-A20307-100UL,ABB-A20307-20UL,ABB-A20307-1000UL,ABB-A20307-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Virus
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: sars-cov-2
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ ORF7a encodes a viral accessory protein. Based on its similarity to other coronavirus proteins, ORF7a protein is thought to be a type I transmembrane protein.
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 43740573
UniProt: P0DTC7
Purity: Affinity purification
Sequence: ELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYS
Target: ORF7a
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: SARS-CoV-2
Western blot analysis of extracts of normal 293T cells and 293T transfected with ORF7a Protein, using SARS-CoV-2 ORF7a Rabbit pAb (A20307) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.