Acetyl-Histone H3-K9 Rabbit mAb, Unconjugated

Produktübersicht

• Artikelname: Acetyl-Histone H3-K9 Rabbit mAb, Unconjugated
• Artikelnummer: ABB-A21107
• Hersteller Artikelnummer: A21107
• Alternativnummer: ABB-A21107-20UL,ABB-A21107-100UL,ABB-A21107-1000UL,ABB-A21107-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: CUT&Tag, ChIP, DOT, ELISA, IF, IHC-P, IP, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: H3/A, H3C2, H3C3, H3C4, H3C6, H3C7, H3C8, H3FA, H3C10, H3C11, H3C12, HIST1H3A, Acetyl-Histone H3-K9

Produktbeschreibung

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails, instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3.

Produkteigenschaften

• Klonalität: Monoclonal
• Klon-Bezeichnung: [ARC50576]
• Molekulargewicht: 15 kDa
• NCBI: 8290
• UniProt: Q16695
• Reinheit: Affinity purification
• Sequenz: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
• Target-Kategorie: H3C1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:30000 - 1:150000|DB,1:500 - 1:1000|IHC-P,1:1000 - 1:4000|IF/ICC,1:1000 - 1:6000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specifi
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat,Other (Wide Range Predicted), ResearchArea: Protein phosphorylation,Signal Transduction,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Cell Cycle,Immunology Inflammation,NF-kB Signaling Pathway,Epigenetics & Nuclear Signaling,Epigenetic Modifications.

Bilder

CUT&,Tag was performed using the CUT&,Tag Assay Kit (pAG-Tn5) for Illumina (RK20265) from 105 K-562 with 1 µg of Acetyl-Histone H3-K9 Rabbit mAb (A21107), followed by incubation with Goat Anti-Rabbit IgG(H+L)(AS070). The CUT&,Tag results denote the enrichment pattern of AAcetyl-Histone H3-K9 Rabbit across chromosome 8 (upper panel) and the genomic region encompassing RPL30, a representative gene enriched in Acetyl-Histone H3-K9 Rabbit (lower panel).

Western blot analysis of various lysates using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at 1:30000 dilutionincubated at room temperature for 1.5 hours. HeLa, NIH/3T3 and C6 cells were treated with TSA (1 µM) at 37°C for 18 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 30 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1 s.

CUT&,Tag was performed using the CUT&,Tag Assay Kit (pAG-Tn5) for Illumina (RK20265) from 105 K-562 cells with 1 µg of Acetyl-Histone H3-K9 Rabbit mAb (A21107), followed by incubation with Goat Anti-Rabbit IgG(H+L)(AS070). The CUT&,Tag results denote the enrichment pattern of Acetyl-Histone H3-K9 around RPL30 gene.

Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat pancreas tissue using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Confocal imaging of HeLa cells (treated with TSA) and HeLa cells (untreated) using Acetyl-Histone H3-K9

Dot-blot analysis of all sorts of peptides using Acetyl-Histone H3-K9 antibody (A21107) at 1:1000 dilution.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human spleen using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse brain using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse intestin using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.