Acetyl-Histone H3-K9 Rabbit mAb, Unconjugated

Product Overview

• Article Name: Acetyl-Histone H3-K9 Rabbit mAb, Unconjugated
• Biozol Catalog Number: ABB-A21107
• Supplier Catalog Number: A21107
• Alternative Catalog Number: ABB-A21107-20UL,ABB-A21107-100UL,ABB-A21107-1000UL,ABB-A21107-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: CUT&Tag, ChIP, DOT, ELISA, IF, IHC-P, IP, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: H3/A, H3C2, H3C3, H3C4, H3C6, H3C7, H3C8, H3FA, H3C10, H3C11, H3C12, HIST1H3A, Acetyl-Histone H3-K9

Product Description

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails, instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3.

Product Properties

• Clonality: Monoclonal
• Clone Designation: [ARC50576]
• Molecular Weight: 15 kDa
• NCBI: 8290
• UniProt: Q16695
• Purity: Affinity purification
• Sequence: MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
• Target: H3C1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:30000 - 1:150000|DB,1:500 - 1:1000|IHC-P,1:1000 - 1:4000|IF/ICC,1:1000 - 1:6000|IP,0.5µg-4µg antibody for 200µg-400µg extracts of whole cells|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specifi
• Application Notes: Cross-Reactivity: Human,Mouse,Rat,Other (Wide Range Predicted), ResearchArea: Protein phosphorylation,Signal Transduction,MAPK-Erk Signaling Pathway,Cell Biology Developmental Biology,Cell Cycle,Immunology Inflammation,NF-kB Signaling Pathway,Epigenetics & Nuclear Signaling,Epigenetic Modifications.

Images

CUT&,Tag was performed using the CUT&,Tag Assay Kit (pAG-Tn5) for Illumina (RK20265) from 105 K-562 with 1 µg of Acetyl-Histone H3-K9 Rabbit mAb (A21107), followed by incubation with Goat Anti-Rabbit IgG(H+L)(AS070). The CUT&,Tag results denote the enrichment pattern of AAcetyl-Histone H3-K9 Rabbit across chromosome 8 (upper panel) and the genomic region encompassing RPL30, a representative gene enriched in Acetyl-Histone H3-K9 Rabbit (lower panel).

Western blot analysis of various lysates using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at 1:30000 dilutionincubated at room temperature for 1.5 hours. HeLa, NIH/3T3 and C6 cells were treated with TSA (1 µM) at 37°C for 18 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 30 µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1 s.

CUT&,Tag was performed using the CUT&,Tag Assay Kit (pAG-Tn5) for Illumina (RK20265) from 105 K-562 cells with 1 µg of Acetyl-Histone H3-K9 Rabbit mAb (A21107), followed by incubation with Goat Anti-Rabbit IgG(H+L)(AS070). The CUT&,Tag results denote the enrichment pattern of Acetyl-Histone H3-K9 around RPL30 gene.

Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis tissue using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat pancreas tissue using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Confocal imaging of HeLa cells (treated with TSA) and HeLa cells (untreated) using Acetyl-Histone H3-K9

Dot-blot analysis of all sorts of peptides using Acetyl-Histone H3-K9 antibody (A21107) at 1:1000 dilution.

Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human liver using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Human spleen using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse brain using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse intestin using Acetyl-Histone H3-K9 Rabbit mAb (A21107) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.