TNFSF10 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: TNFSF10 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A2138
• Hersteller Artikelnummer: A2138
• Alternativnummer: ABB-A2138-1000UL,ABB-A2138-20UL,ABB-A2138-50UL,ABB-A2138-500UL,ABB-A2138-100UL,ABB-A2138-200UL,ABB-A2138-5UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 50-160 of human TNFSF10 (NP_003801.1).
• Konjugation: Unconjugated
• Alternative Synonym: TL2, APO2L, CD253, TANCR, TRAIL, Apo-2L, TNLG6A, TNFSF10

Produktbeschreibung

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein preferentially induces apoptosis in transformed and tumor cells, but does not appear to kill normal cells although it is expressed

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 33kDa
• NCBI: 8743
• UniProt: P50591
• Quelle: Rabbit
• Reinheit: Affinity purification
• Sequenz: SKSGIACFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSG
• Target-Kategorie: TNFSF10
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000
• Anwendungsbeschreibung: Cross-reactivity: Human, Research area: Cancer,Invasion and Metastasis,Cell Biology Developmental Biology,Apoptosis,Death Receptor Signaling Pathway,Immunology Inflammation,CDs,Cytokines,Cardiovascular