TNFSF10 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: TNFSF10 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2138
• Supplier Catalog Number: A2138
• Alternative Catalog Number: ABB-A2138-1000UL,ABB-A2138-20UL,ABB-A2138-50UL,ABB-A2138-500UL,ABB-A2138-100UL,ABB-A2138-200UL,ABB-A2138-5UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 50-160 of human TNFSF10 (NP_003801.1).
• Conjugation: Unconjugated
• Alternative Names: TL2, APO2L, CD253, TANCR, TRAIL, Apo-2L, TNLG6A, TNFSF10

Product Description

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This protein preferentially induces apoptosis in transformed and tumor cells, but does not appear to kill normal cells although it is expressed

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 33kDa
• NCBI: 8743
• UniProt: P50591
• Source: Rabbit
• Purity: Affinity purification
• Sequence: SKSGIACFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETISTVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSG
• Target: TNFSF10
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000
• Application Notes: Cross-reactivity: Human, Research area: Cancer,Invasion and Metastasis,Cell Biology Developmental Biology,Apoptosis,Death Receptor Signaling Pathway,Immunology Inflammation,CDs,Cytokines,Cardiovascular