HDAC3 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: HDAC3 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A2139
• Hersteller Artikelnummer: A2139
• Alternativnummer: ABB-A2139-20UL,ABB-A2139-50UL,ABB-A2139-500UL,ABB-A2139-100UL,ABB-A2139-1000UL,ABB-A2139-200UL,ABB-A2139-5UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 319-428 of human HDAC3 (O15379).
• Konjugation: Unconjugated
• Alternative Synonym: HD3, RPD3, KDAC3, RPD3-2, HDAC3

Produktbeschreibung

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 49kDa
• NCBI: 8841
• UniProt: O15379
• Quelle: Rabbit
• Reinheit: Affinity purification
• Sequenz: ISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
• Target-Kategorie: HDAC3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200
• Anwendungsbeschreibung: Cross-reactivity: Human,Mouse,Rat, Research area: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Cancer,Tumor suppressors,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell Cycle Control-G1 S Checkpoint,Wnt -Cate