HDAC3 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: HDAC3 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A2139
• Supplier Catalog Number: A2139
• Alternative Catalog Number: ABB-A2139-20UL,ABB-A2139-50UL,ABB-A2139-500UL,ABB-A2139-100UL,ABB-A2139-1000UL,ABB-A2139-200UL,ABB-A2139-5UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, IF, IHC-P, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 319-428 of human HDAC3 (O15379).
• Conjugation: Unconjugated
• Alternative Names: HD3, RPD3, KDAC3, RPD3-2, HDAC3

Product Description

Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 49kDa
• NCBI: 8841
• UniProt: O15379
• Source: Rabbit
• Purity: Affinity purification
• Sequence: ISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
• Target: HDAC3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200
• Application Notes: Cross-reactivity: Human,Mouse,Rat, Research area: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Cancer,Tumor suppressors,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Cell Cycle,Cell Cycle Control-G1 S Checkpoint,Wnt -Cate