Lrwd1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: Lrwd1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A21399
• Hersteller Artikelnummer: A21399
• Alternativnummer: ABB-A21399-200UL,ABB-A21399-1000UL,ABB-A21399-100UL,ABB-A21399-50UL,ABB-A21399-20UL,ABB-A21399-500UL,ABB-A21399-5UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Lrwd1 (NP_690852.1).
• Konjugation: Unconjugated
• Alternative Synonym: ORCA, CENP-33, Lrwd1

Produktbeschreibung

The protein encoded by this gene interacts with components of the origin recognition complex (ORC) and regulates the formation of the prereplicative complex. The encoded protein stabilizes the ORC and therefore aids in DNA replication. This protein is re

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 71kDa
• NCBI: 222229
• UniProt: Q9UFC0
• Quelle: Rabbit
• Reinheit: Affinity purification
• Sequenz: ASPSAQVEGSPVAGSDGSQPAVKLEPLHFLQCHSKNNSPQDLETQLWACAFEPAWEEGATSQTVATCGGEAVCVIDCQTGIVLHKYKAPGEEFFSVAWTAL
• Target-Kategorie: LRWD1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:2000
• Anwendungsbeschreibung: Cross-reactivity: Human, Research area: Cell Biology & Developmental Biology,