Lrwd1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Lrwd1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A21399
• Supplier Catalog Number: A21399
• Alternative Catalog Number: ABB-A21399-200UL,ABB-A21399-1000UL,ABB-A21399-100UL,ABB-A21399-50UL,ABB-A21399-20UL,ABB-A21399-500UL,ABB-A21399-5UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human Lrwd1 (NP_690852.1).
• Conjugation: Unconjugated
• Alternative Names: ORCA, CENP-33, Lrwd1

Product Description

The protein encoded by this gene interacts with components of the origin recognition complex (ORC) and regulates the formation of the prereplicative complex. The encoded protein stabilizes the ORC and therefore aids in DNA replication. This protein is re

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 71kDa
• NCBI: 222229
• UniProt: Q9UFC0
• Source: Rabbit
• Purity: Affinity purification
• Sequence: ASPSAQVEGSPVAGSDGSQPAVKLEPLHFLQCHSKNNSPQDLETQLWACAFEPAWEEGATSQTVATCGGEAVCVIDCQTGIVLHKYKAPGEEFFSVAWTAL
• Target: LRWD1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:2000
• Application Notes: Cross-reactivity: Human, Research area: Cell Biology & Developmental Biology,