TIFY10A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A21960
Artikelname: TIFY10A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A21960
Hersteller Artikelnummer: A21960
Alternativnummer: ABB-A21960-200UL,ABB-A21960-50UL,ABB-A21960-100UL,ABB-A21960-20UL,ABB-A21960-1000UL,ABB-A21960-500UL,ABB-A21960-5UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: A. thaliana
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 154-253 of arabidopsis thaliana TIFY10A (NP_564075.1).
Konjugation: Unconjugated
Alternative Synonym: AtJAZ1, jasmonate-zim-domain protein 1, T29M8.5, T29M8_5, TIFY10A
JAZ1 is a nuclear-localized protein involved in jasmonate signaling. JAZ1 transcript levels rise in response to a jasmonate stimulus. JAZ1 can interact with the COI1 F-box subunit of an SCF E3 ubiquitin ligase in a yeast-two-hybrid assay only in the pres
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 838501
UniProt: Q9LMA8
Quelle: Rabbit
Reinheit: Affinity purification
Sequenz: SKGTANSLAKNQTDIRSNIATIANQVPHPRKTTTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVTSKAPYQLCDPAKASSNPQTTGNMSWLGLAAEI
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000
Anwendungsbeschreibung: Cross-reactivity: Arabidopsis thaliana