TIFY10A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A21960
Article Name: TIFY10A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A21960
Supplier Catalog Number: A21960
Alternative Catalog Number: ABB-A21960-200UL,ABB-A21960-50UL,ABB-A21960-100UL,ABB-A21960-20UL,ABB-A21960-1000UL,ABB-A21960-500UL,ABB-A21960-5UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: A. thaliana
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 154-253 of arabidopsis thaliana TIFY10A (NP_564075.1).
Conjugation: Unconjugated
Alternative Names: AtJAZ1, jasmonate-zim-domain protein 1, T29M8.5, T29M8_5, TIFY10A
JAZ1 is a nuclear-localized protein involved in jasmonate signaling. JAZ1 transcript levels rise in response to a jasmonate stimulus. JAZ1 can interact with the COI1 F-box subunit of an SCF E3 ubiquitin ligase in a yeast-two-hybrid assay only in the pres
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 838501
UniProt: Q9LMA8
Source: Rabbit
Purity: Affinity purification
Sequence: SKGTANSLAKNQTDIRSNIATIANQVPHPRKTTTQEPIQSSPTPLTELPIARRASLHRFLEKRKDRVTSKAPYQLCDPAKASSNPQTTGNMSWLGLAAEI
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000
Application Notes: Cross-reactivity: Arabidopsis thaliana