Desmocollin 3 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: Desmocollin 3 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A22232
• Hersteller Artikelnummer: A22232
• Alternativnummer: ABB-A22232-200UL,ABB-A22232-50UL,ABB-A22232-20UL,ABB-A22232-500UL,ABB-A22232-1000UL,ABB-A22232-100UL,ABB-A22232-5UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 576-690 of human Desmocollin 3 (NP_001932.2).
• Konjugation: Unconjugated
• Alternative Synonym: DSC, DSC1, DSC2, DSC4, CDHF3, HT-CP, Desmocollin 3

Produktbeschreibung

The protein encoded by this gene is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where the

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 100kDa
• NCBI: 1825
• UniProt: Q14574
• Quelle: Rabbit
• Reinheit: Affinity purification
• Sequenz: EILQEYVVICKPKMGYTDILAVDPDEPVHGAPFYFSLPNTSPEISRLWSLTKVNDTAARLSYQKNAGFQEYTIPITVKDRAGQAATKLLRVNLCECTHPTQCRATSRSTGVILGK
• Target-Kategorie: DSC3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:100 - 1:500
• Anwendungsbeschreibung: Cross-reactivity: Rat, Research area: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cadherins,Cytoskeleton