Desmocollin 3 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Desmocollin 3 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A22232
• Supplier Catalog Number: A22232
• Alternative Catalog Number: ABB-A22232-200UL,ABB-A22232-50UL,ABB-A22232-20UL,ABB-A22232-500UL,ABB-A22232-1000UL,ABB-A22232-100UL,ABB-A22232-5UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 576-690 of human Desmocollin 3 (NP_001932.2).
• Conjugation: Unconjugated
• Alternative Names: DSC, DSC1, DSC2, DSC4, CDHF3, HT-CP, Desmocollin 3

Product Description

The protein encoded by this gene is a calcium-dependent glycoprotein that is a member of the desmocollin subfamily of the cadherin superfamily. These desmosomal family members, along with the desmogleins, are found primarily in epithelial cells where the

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 100kDa
• NCBI: 1825
• UniProt: Q14574
• Source: Rabbit
• Purity: Affinity purification
• Sequence: EILQEYVVICKPKMGYTDILAVDPDEPVHGAPFYFSLPNTSPEISRLWSLTKVNDTAARLSYQKNAGFQEYTIPITVKDRAGQAATKLLRVNLCECTHPTQCRATSRSTGVILGK
• Target: DSC3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:100 - 1:500
• Application Notes: Cross-reactivity: Rat, Research area: Signal Transduction,Cell Biology Developmental Biology,Cell Adhesion,Cadherins,Cytoskeleton