HNRNPUL1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A22236
Artikelname: HNRNPUL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A22236
Hersteller Artikelnummer: A22236
Alternativnummer: ABB-A22236-500UL,ABB-A22236-1000UL,ABB-A22236-20UL,ABB-A22236-200UL,ABB-A22236-100UL,ABB-A22236-50UL,ABB-A22236-5UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 209-410 of human HNRNPUL1 (NP_008971.2).
Konjugation: Unconjugated
Alternative Synonym: E1BAP5, E1B-AP5, HNRPUL1, HNRNPUL1
This gene encodes a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus early-1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport, and
Klonalität: Polyclonal
Molekulargewicht: 83kDa
NCBI: 11100
UniProt: P40939
Quelle: Rabbit
Reinheit: Affinity purification
Sequenz: TLVAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIR
Target-Kategorie: HNRNPUL1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:100 - 1:500
Anwendungsbeschreibung: Cross-reactivity: Human,Mouse, Research area: Epigenetics Nuclear Signaling,RNA Binding