HNRNPUL1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A22236
Article Name: HNRNPUL1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A22236
Supplier Catalog Number: A22236
Alternative Catalog Number: ABB-A22236-500UL,ABB-A22236-1000UL,ABB-A22236-20UL,ABB-A22236-200UL,ABB-A22236-100UL,ABB-A22236-50UL,ABB-A22236-5UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 209-410 of human HNRNPUL1 (NP_008971.2).
Conjugation: Unconjugated
Alternative Names: E1BAP5, E1B-AP5, HNRPUL1, HNRNPUL1
This gene encodes a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus early-1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport, and
Clonality: Polyclonal
Molecular Weight: 83kDa
NCBI: 11100
UniProt: P40939
Source: Rabbit
Purity: Affinity purification
Sequence: TLVAIDTYNCDLHFKVARDRSSGYPLTIEGFAYLWSGARASYGVRRGRVCFEMKINEEISVKHLPSTEPDPHVVRIGWSLDSCSTQLGEEPFSYGYGGTGKKSTNSRFENYGDKFAENDVIGCFADFECGNDVELSFTKNGKWMGIAFRIQKEALGGQALYPHVLVKNCAVEFNFGQRAEPYCSVLPGFTFIQHLPLSERIR
Target: HNRNPUL1
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500
Application Notes: Cross-reactivity: Human,Mouse, Research area: Epigenetics Nuclear Signaling,RNA Binding