KAT2A Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: KAT2A Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A2224
• Hersteller Artikelnummer: A2224
• Alternativnummer: ABB-A2224-1000UL,ABB-A2224-50UL,ABB-A2224-500UL,ABB-A2224-200UL,ABB-A2224-20UL,ABB-A2224-100UL,ABB-A2224-5UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, IF, IHC-P, WB
• Spezies Reaktivität: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human KAT2A (NP_066564.2).
• Konjugation: Unconjugated
• Alternative Synonym: GCN5, hGCN5, GCN5L2, PCAF-b, KAT2A

Produktbeschreibung

KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It also functions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA (MIM 164014) in a HAT

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 94kDa
• NCBI: 2648
• UniProt: Q92830
• Quelle: Rabbit
• Reinheit: Affinity purification
• Sequenz: MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPIPTPTPAPAPAPAAAPAGSTGTGGPGVGSGGAGSGGDPARPGLSQQQRASQRKAQVRGLPRA
• Target-Kategorie: KAT2A
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200|IHC-P,1:50 - 1:200
• Anwendungsbeschreibung: Cross-reactivity: Human,Mouse,Rat, Research area: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Nuclear Receptor Signaling,Signal Transduction,Cell Biology Developmental Biology