KAT2A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A2224
Article Name: KAT2A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A2224
Supplier Catalog Number: A2224
Alternative Catalog Number: ABB-A2224-1000UL,ABB-A2224-50UL,ABB-A2224-500UL,ABB-A2224-200UL,ABB-A2224-20UL,ABB-A2224-100UL,ABB-A2224-5UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human KAT2A (NP_066564.2).
Conjugation: Unconjugated
Alternative Names: GCN5, hGCN5, GCN5L2, PCAF-b, KAT2A
KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It also functions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA (MIM 164014) in a HAT
Clonality: Polyclonal
Molecular Weight: 94kDa
NCBI: 2648
UniProt: Q92830
Source: Rabbit
Purity: Affinity purification
Sequence: MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPIPTPTPAPAPAPAAAPAGSTGTGGPGVGSGGAGSGGDPARPGLSQQQRASQRKAQVRGLPRA
Target: KAT2A
Antibody Type: Primary Antibody
Application Dilute: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200|IHC-P,1:50 - 1:200
Application Notes: Cross-reactivity: Human,Mouse,Rat, Research area: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Nuclear Receptor Signaling,Signal Transduction,Cell Biology Developmental Biology