EXT1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: EXT1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A24353
• Hersteller Artikelnummer: A24353
• Alternativnummer: ABB-A24353-20UL,ABB-A24353-100UL,ABB-A24353-1000UL,ABB-A24353-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: EXT, LGS, TTV, LGCR, TRPS2, EXT1

Produktbeschreibung

This gene encodes an endoplasmic reticulum-resident type II transmembrane glycosyltransferase involved in the chain elongation step of heparan sulfate biosynthesis. Mutations in this gene cause the type I form of multiple exostoses.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 86kDa
• NCBI: 2131
• UniProt: Q16394
• Reinheit: Affinity purification
• Sequenz: HGKDWQKHKDSRCDRDNTEYEKYDYREMLHNATFCLVPRGRRLGSFRFLEALQAACVPVMLSNGWELPFSEVINWNQAAVIGDERLLLQIPSTIRSIHQDK
• Target-Kategorie: EXT1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates, using EXT1 Rabbit pAb (A24353) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.