EXT1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: EXT1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A24353
• Supplier Catalog Number: A24353
• Alternative Catalog Number: ABB-A24353-20UL,ABB-A24353-100UL,ABB-A24353-1000UL,ABB-A24353-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: EXT, LGS, TTV, LGCR, TRPS2, EXT1

Product Description

This gene encodes an endoplasmic reticulum-resident type II transmembrane glycosyltransferase involved in the chain elongation step of heparan sulfate biosynthesis. Mutations in this gene cause the type I form of multiple exostoses.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 86kDa
• NCBI: 2131
• UniProt: Q16394
• Purity: Affinity purification
• Sequence: HGKDWQKHKDSRCDRDNTEYEKYDYREMLHNATFCLVPRGRRLGSFRFLEALQAACVPVMLSNGWELPFSEVINWNQAAVIGDERLLLQIPSTIRSIHQDK
• Target: EXT1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton. Shipping: Ice Bag

Images

Western blot analysis of various lysates, using EXT1 Rabbit pAb (A24353) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.