PIM1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PIM1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A24475
• Hersteller Artikelnummer: A24475
• Alternativnummer: ABB-A24475-100UL,ABB-A24475-20UL,ABB-A24475-1000UL,ABB-A24475-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PIM1, PIM, serine/threonine-protein kinase pim-1

Produktbeschreibung

The protein encoded by this gene belongs to the Ser/Thr protein kinase family, and PIM subfamily. This gene is expressed primarily in B-lymphoid and myeloid cell lines, and is overexpressed in hematopoietic malignancies and in prostate cancer. It plays a role in signal transduction in blood cells, contributing to both cell proliferation and survival, and thus provides a selective advantage in tumorigenesis. Both the human and orthologous mouse genes have been reported to encode two isoforms (with preferential cellular localization) resulting from the use of alternative in-frame translation initiation codons, the upstream non-AUG (CUG) and downstream AUG codons (PMIDs:16186805, 1825810).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 35kDa/45kDa
• NCBI: 5292
• UniProt: P11309
• Reinheit: Affinity purification
• Sequenz: IRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK
• Target-Kategorie: PIM1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics & Nuclear Signaling,Chromatin Modifying Enzymes,Phosphorylation,Chromatin Remodeling,Cancer,Signal Transduction,Kinase,Serine/threonine kinases,Cell Biology & Developmental Biology,Apoptosis,Immunology & Inflammation,IL-6 Receptor Signaling Pathway,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Rat kidney, using PIM1 Rabbit pAb (A24475) at 1:600 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.