PIM1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24475
Article Name: PIM1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24475
Supplier Catalog Number: A24475
Alternative Catalog Number: ABB-A24475-100UL,ABB-A24475-20UL,ABB-A24475-1000UL,ABB-A24475-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PIM1, PIM, serine/threonine-protein kinase pim-1
The protein encoded by this gene belongs to the Ser/Thr protein kinase family, and PIM subfamily. This gene is expressed primarily in B-lymphoid and myeloid cell lines, and is overexpressed in hematopoietic malignancies and in prostate cancer. It plays a role in signal transduction in blood cells, contributing to both cell proliferation and survival, and thus provides a selective advantage in tumorigenesis. Both the human and orthologous mouse genes have been reported to encode two isoforms (with preferential cellular localization) resulting from the use of alternative in-frame translation initiation codons, the upstream non-AUG (CUG) and downstream AUG codons (PMIDs:16186805, 1825810).
Clonality: Polyclonal
Molecular Weight: 35kDa/45kDa
NCBI: 5292
UniProt: P11309
Purity: Affinity purification
Sequence: IRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK
Target: PIM1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics & Nuclear Signaling,Chromatin Modifying Enzymes,Phosphorylation,Chromatin Remodeling,Cancer,Signal Transduction,Kinase,Serine/threonine kinases,Cell Biology & Developmental Biology,Apoptosis,Immunology & Inflammation,IL-6 Receptor Signaling Pathway,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag
Western blot analysis of lysates from Rat kidney, using PIM1 Rabbit pAb (A24475) at 1:600 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.