GIF Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A24479
Artikelname: GIF Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A24479
Hersteller Artikelnummer: A24479
Alternativnummer: ABB-A24479-100UL,ABB-A24479-20UL,ABB-A24479-500UL,ABB-A24479-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GIF, IF, IFMH, INF, TCN3, gastric intrinsic factor
This gene is a member of the cobalamin transport protein family. It encodes a glycoprotein secreted by parietal cells of the gastric mucosa and is required for adequate absorption of vitamin B12. Vitamin B12 is necessary for erythrocyte maturation and mutations in this gene may lead to congenital pernicious anemia.
Klonalität: Polyclonal
Molekulargewicht: 42kDa/45kDa
NCBI: 2694
UniProt: P27352
Reinheit: Affinity purification
Sequenz: STQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILP
Target-Kategorie: CBLIF
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine & Metabolism. Shipping: Ice Bag
Western blot analysis of lysates from Mouse stomach, using GIF Rabbit pAb (A24479) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.