GIF Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A24479
Article Name: GIF Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A24479
Supplier Catalog Number: A24479
Alternative Catalog Number: ABB-A24479-100UL,ABB-A24479-20UL,ABB-A24479-500UL,ABB-A24479-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: GIF, IF, IFMH, INF, TCN3, gastric intrinsic factor
This gene is a member of the cobalamin transport protein family. It encodes a glycoprotein secreted by parietal cells of the gastric mucosa and is required for adequate absorption of vitamin B12. Vitamin B12 is necessary for erythrocyte maturation and mutations in this gene may lead to congenital pernicious anemia.
Clonality: Polyclonal
Molecular Weight: 42kDa/45kDa
NCBI: 2694
UniProt: P27352
Purity: Affinity purification
Sequence: STQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILP
Target: CBLIF
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Endocrine & Metabolism. Shipping: Ice Bag
Western blot analysis of lysates from Mouse stomach, using GIF Rabbit pAb (A24479) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.