CD53 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CD53 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A24527
• Hersteller Artikelnummer: A24527
• Alternativnummer: ABB-A24527-20UL,ABB-A24527-100UL,ABB-A24527-500UL,ABB-A24527-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: Ox-44, Tspan25, CD53

Produktbeschreibung

Predicted to enable identical protein binding activity. Involved in positive regulation of myoblast fusion. Located in cell-cell junction and plasma membrane. Is expressed in several structures, including alimentary system, brain, genitourinary system, hemolymphoid system gland, and liver and biliary system. Orthologous to human CD53 (CD53 molecule).

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 24kDa
• NCBI: 12508
• UniProt: Q61451
• Reinheit: Affinity purification
• Sequenz: EQKLNTLVAEGLNDSIQHYHSDNSTMKAWDFIQTQLQCCGVNGSSDWTSGPPSSCPSGADVQGCYNKAKSWFHSN
• Target-Kategorie: Cd53
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Mouse spleen, using CD53 Rabbit pAb (A24527) at 1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.