CD53 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CD53 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A24527
• Supplier Catalog Number: A24527
• Alternative Catalog Number: ABB-A24527-20UL,ABB-A24527-100UL,ABB-A24527-500UL,ABB-A24527-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Ox-44, Tspan25, CD53

Product Description

Predicted to enable identical protein binding activity. Involved in positive regulation of myoblast fusion. Located in cell-cell junction and plasma membrane. Is expressed in several structures, including alimentary system, brain, genitourinary system, hemolymphoid system gland, and liver and biliary system. Orthologous to human CD53 (CD53 molecule).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 24kDa
• NCBI: 12508
• UniProt: Q61451
• Purity: Affinity purification
• Sequence: EQKLNTLVAEGLNDSIQHYHSDNSTMKAWDFIQTQLQCCGVNGSSDWTSGPPSSCPSGADVQGCYNKAKSWFHSN
• Target: Cd53
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse spleen, using CD53 Rabbit pAb (A24527) at 1:800 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.