SLC25A11 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: SLC25A11 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A25022
• Hersteller Artikelnummer: A25022
• Alternativnummer: ABB-A25022-20UL,ABB-A25022-100UL,ABB-A25022-1000UL,ABB-A25022-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: OGC, PGL6, SLC20A4, SLC25A11

Produktbeschreibung

The oxoglutarate/malate carrier transports 2-oxoglutarate across the inner membranes of mitochondria in an electroneutral exchange for malate or other dicarboxylic acids (summary by Iacobazzi et al., 1992

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 34kDa
• NCBI: 8402
• UniProt: Q02978
• Reinheit: Affinity purification
• Sequenz: MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLG
• Target-Kategorie: SLC25A11
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction, Metabolism, Energy Metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates using SLC25A11 Rabbit pAb (A25022) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:45s.