SLC25A11 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: SLC25A11 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25022
• Supplier Catalog Number: A25022
• Alternative Catalog Number: ABB-A25022-20UL,ABB-A25022-100UL,ABB-A25022-1000UL,ABB-A25022-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: OGC, PGL6, SLC20A4, SLC25A11

Product Description

The oxoglutarate/malate carrier transports 2-oxoglutarate across the inner membranes of mitochondria in an electroneutral exchange for malate or other dicarboxylic acids (summary by Iacobazzi et al., 1992

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 34kDa
• NCBI: 8402
• UniProt: Q02978
• Purity: Affinity purification
• Sequence: MAATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREYKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLG
• Target: SLC25A11
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction, Metabolism, Energy Metabolism. Shipping: Ice Bag

Images

Western blot analysis of various lysates using SLC25A11 Rabbit pAb (A25022) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 µg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:45s.