E-Selectin/CD62E Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A25027
Artikelname: E-Selectin/CD62E Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A25027
Hersteller Artikelnummer: A25027
Alternativnummer: ABB-A25027-100UL,ABB-A25027-20UL,ABB-A25027-1000UL,ABB-A25027-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Mouse
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: Elam, CD62E, ELAM-1, LECAM2, E-selectin, E-Selectin/CD62E
Predicted to enable several functions, including oligosaccharide binding activity, phospholipase binding activity, and sialic acid binding activity. Involved in positive regulation of leukocyte tethering or rolling. Acts upstream of or within positive regulation of leukocyte migration. Predicted to be located in several cellular components, including caveola, clathrin-coated pit, and perinuclear region of cytoplasm. Predicted to be integral component of plasma membrane. Predicted to be active in external side of plasma membrane and extracellular space. Is expressed in several structures, including adrenal gland, genitourinary system, incisor, integumental system, and limb segment. Human ortholog(s) of this gene implicated in IgA glomerulonephritis, brain ischemia, cerebrovascular disease, and coronary artery disease. Orthologous to human SELE (selectin E).
Klonalität: Polyclonal
Molekulargewicht: 66kDa
NCBI: 20339
UniProt: Q00690
Reinheit: Affinity purification
Sequenz: WYYNASSELMTYDEASAYCQRDYTHLVAIQNKEEINYLNSNLKHSPSYYWIGIRKVNNVWIWVGTGKPLTEEAQNWAPGEPNNKQRNEDCVEIYIQRTKDSGMWNDERCNKKKLALCYTASCTNASCSGHGECIETINSYTCKCHPGFLGPNCEQAVTCKPQEHPDYGSLNCSHPFGPFSYNSSCSFGCKRGYLPSSMETTVRCTSSGEWSAPAPACHVVECEALTHPAHGIRKCSSNPGSYPWNTTCTFDCVEG
Target-Kategorie: CGA/TSHB
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Immunology, Cell Type Markers, CD, Adhesion, Cardiovascular, Atherosclerosis, Vascular Inflammation, Leukocyte recruitment ,Cell adhesion molecules,Stem Cells, Endothelial Progenitors, Endothelial Markers,Kits/ Lysates/ Other, Kits ,ELISA Kits ,ELISA Kits ,Adhesion molecules ELISA kits. Shipping: Ice Bag
Western blot analysis of lysates from wild type (WT) and293T cells transfected withE-Selectin/CD62E usingE-Selectin/CD62E Rabbit pAb (A25027) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:5s.