E-Selectin/CD62E Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: E-Selectin/CD62E Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25027
• Supplier Catalog Number: A25027
• Alternative Catalog Number: ABB-A25027-100UL,ABB-A25027-20UL,ABB-A25027-1000UL,ABB-A25027-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Mouse
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: Elam, CD62E, ELAM-1, LECAM2, E-selectin, E-Selectin/CD62E

Product Description

Predicted to enable several functions, including oligosaccharide binding activity, phospholipase binding activity, and sialic acid binding activity. Involved in positive regulation of leukocyte tethering or rolling. Acts upstream of or within positive regulation of leukocyte migration. Predicted to be located in several cellular components, including caveola, clathrin-coated pit, and perinuclear region of cytoplasm. Predicted to be integral component of plasma membrane. Predicted to be active in external side of plasma membrane and extracellular space. Is expressed in several structures, including adrenal gland, genitourinary system, incisor, integumental system, and limb segment. Human ortholog(s) of this gene implicated in IgA glomerulonephritis, brain ischemia, cerebrovascular disease, and coronary artery disease. Orthologous to human SELE (selectin E).

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 66kDa
• NCBI: 20339
• UniProt: Q00690
• Purity: Affinity purification
• Sequence: WYYNASSELMTYDEASAYCQRDYTHLVAIQNKEEINYLNSNLKHSPSYYWIGIRKVNNVWIWVGTGKPLTEEAQNWAPGEPNNKQRNEDCVEIYIQRTKDSGMWNDERCNKKKLALCYTASCTNASCSGHGECIETINSYTCKCHPGFLGPNCEQAVTCKPQEHPDYGSLNCSHPFGPFSYNSSCSFGCKRGYLPSSMETTVRCTSSGEWSAPAPACHVVECEALTHPAHGIRKCSSNPGSYPWNTTCTFDCVEG
• Target: CGA/TSHB
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Immunology, Cell Type Markers, CD, Adhesion, Cardiovascular, Atherosclerosis, Vascular Inflammation, Leukocyte recruitment ,Cell adhesion molecules,Stem Cells, Endothelial Progenitors, Endothelial Markers,Kits/ Lysates/ Other, Kits ,ELISA Kits ,ELISA Kits ,Adhesion molecules ELISA kits. Shipping: Ice Bag

Images

Western blot analysis of lysates from wild type (WT) and293T cells transfected withE-Selectin/CD62E usingE-Selectin/CD62E Rabbit pAb (A25027) at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:5s.