DHRS1 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: DHRS1 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A25038
• Hersteller Artikelnummer: A25038
• Alternativnummer: ABB-A25038-20UL,ABB-A25038-100UL,ABB-A25038-1000UL,ABB-A25038-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: SDR19C1, DHRS1

Produktbeschreibung

This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded enzyme contains a conserved catalytic domain and likely functions as an oxidoreductase. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 34kDa
• NCBI: 115817
• UniProt: Q96LJ7
• Reinheit: Affinity purification
• Sequenz: MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPS
• Target-Kategorie: DHRS1
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Cell Biology, Other Antibodies, Other Antibodies. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Mouse colon usingDHRS1 Rabbit pAb (A25038) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.