DHRS1 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: DHRS1 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25038
• Supplier Catalog Number: A25038
• Alternative Catalog Number: ABB-A25038-20UL,ABB-A25038-100UL,ABB-A25038-1000UL,ABB-A25038-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: SDR19C1, DHRS1

Product Description

This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded enzyme contains a conserved catalytic domain and likely functions as an oxidoreductase. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 34kDa
• NCBI: 115817
• UniProt: Q96LJ7
• Purity: Affinity purification
• Sequence: MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPS
• Target: DHRS1
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Cell Biology, Other Antibodies, Other Antibodies. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse colon usingDHRS1 Rabbit pAb (A25038) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.