CD22 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: CD22 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A25054
• Hersteller Artikelnummer: A25054
• Alternativnummer: ABB-A25054-100UL,ABB-A25054-20UL,ABB-A25054-500UL,ABB-A25054-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: SIGLEC2, SIGLEC-2, CD22

Produktbeschreibung

Predicted to enable CD4 receptor binding activity, protein phosphatase binding activity, and sialic acid binding activity. Involved in B cell activation, negative regulation of B cell receptor signaling pathway, and regulation of endocytosis. Located in early endosome and recycling endosome.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 95kDa
• NCBI: 933
• UniProt: P20273
• Reinheit: Affinity purification
• Sequenz: MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNK
• Target-Kategorie: CD22
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cancer,Tumor immunology,Tumor-associated antigens,Tumor biomarkers,Immunology Inflammation,CDs,B Cell Receptor Signaling Pathway,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag

Bilder

Western blot analysis of various lysates usingCD22 Rabbit pAb (A25054) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC):Jurkat.
Exposure time:60s.