CD22 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: CD22 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25054
• Supplier Catalog Number: A25054
• Alternative Catalog Number: ABB-A25054-100UL,ABB-A25054-20UL,ABB-A25054-500UL,ABB-A25054-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: SIGLEC2, SIGLEC-2, CD22

Product Description

Predicted to enable CD4 receptor binding activity, protein phosphatase binding activity, and sialic acid binding activity. Involved in B cell activation, negative regulation of B cell receptor signaling pathway, and regulation of endocytosis. Located in early endosome and recycling endosome.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 95kDa
• NCBI: 933
• UniProt: P20273
• Purity: Affinity purification
• Sequence: MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNK
• Target: CD22
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Cancer,Tumor immunology,Tumor-associated antigens,Tumor biomarkers,Immunology Inflammation,CDs,B Cell Receptor Signaling Pathway,Stem Cells,Hematopoietic Progenitors. Shipping: Ice Bag

Images

Western blot analysis of various lysates usingCD22 Rabbit pAb (A25054) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC):Jurkat.
Exposure time:60s.