PADI4 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: PADI4 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A25102
• Hersteller Artikelnummer: A25102
• Alternativnummer: ABB-A25102-100UL,ABB-A25102-20UL,ABB-A25102-1000UL,ABB-A25102-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: PAD, PAD4, PDI4, PDI5, PADI5, PADI4

Produktbeschreibung

This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 74kDa
• NCBI: 23569
• UniProt: Q9UM07
• Reinheit: Affinity purification
• Sequenz: DEMEIGYIQAPHKTLPVVFDSPRNRGLKEFPIKRVMGPDFGYVTRGPQTGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQALQDF
• Target-Kategorie: PADI4
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Cancer,Signal Transduction,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from wild type (WT) and293F cells transfected withPADI4 usingPADI4 Rabbit pAb (A25102) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:90s.