PADI4 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: PADI4 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25102
• Supplier Catalog Number: A25102
• Alternative Catalog Number: ABB-A25102-100UL,ABB-A25102-20UL,ABB-A25102-1000UL,ABB-A25102-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: PAD, PAD4, PDI4, PDI5, PADI5, PADI4

Product Description

This gene is a member of a gene family which encodes enzymes responsible for the conversion of arginine residues to citrulline residues. This gene may play a role in granulocyte and macrophage development leading to inflammation and immune response.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 74kDa
• NCBI: 23569
• UniProt: Q9UM07
• Purity: Affinity purification
• Sequence: DEMEIGYIQAPHKTLPVVFDSPRNRGLKEFPIKRVMGPDFGYVTRGPQTGGISGLDSFGNLEVSPPVTVRGKEYPLGRILFGDSCYPSNDSRQMHQALQDF
• Target: PADI4
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Epigenetics Nuclear Signaling,Epigenetic writers and erasers of core Histones,Cancer,Signal Transduction,Endocrine Metabolism,Amino acid metabolism. Shipping: Ice Bag

Images

Western blot analysis of lysates from wild type (WT) and293F cells transfected withPADI4 usingPADI4 Rabbit pAb (A25102) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:90s.