ACSM3 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ACSM3 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A25104
• Hersteller Artikelnummer: A25104
• Alternativnummer: ABB-A25104-100UL,ABB-A25104-20UL,ABB-A25104-1000UL,ABB-A25104-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: SA, SAH, ACSM3

Produktbeschreibung

Enables butyrate-CoA ligase activity. Predicted to be involved in acyl-CoA metabolic process and fatty acid biosynthetic process. Located in mitochondrion. Implicated in IgA glomerulonephritis. Biomarker of ulcerative colitis.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 66kDa
• NCBI: 6296
• UniProt: Q53FZ2
• Reinheit: Affinity purification
• Sequenz: LHKDNRTATPQNFSNYESMKQDFKLGIPEYFNFAKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMRWSFEELGSLSRKFANILSEACSLQRGDRVILILPRV
• Target-Kategorie: ACSM3
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Lipid Metabolism,Cardiovascular,Blood,Lipids,Fatty Acids. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Mouse kidney usingACSM3 Rabbit pAb (A25104) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.