ACSM3 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: ACSM3 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25104
• Supplier Catalog Number: A25104
• Alternative Catalog Number: ABB-A25104-100UL,ABB-A25104-20UL,ABB-A25104-1000UL,ABB-A25104-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: SA, SAH, ACSM3

Product Description

Enables butyrate-CoA ligase activity. Predicted to be involved in acyl-CoA metabolic process and fatty acid biosynthetic process. Located in mitochondrion. Implicated in IgA glomerulonephritis. Biomarker of ulcerative colitis.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 66kDa
• NCBI: 6296
• UniProt: Q53FZ2
• Purity: Affinity purification
• Sequence: LHKDNRTATPQNFSNYESMKQDFKLGIPEYFNFAKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMRWSFEELGSLSRKFANILSEACSLQRGDRVILILPRV
• Target: ACSM3
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Mouse. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Lipid Metabolism,Cardiovascular,Blood,Lipids,Fatty Acids. Shipping: Ice Bag

Images

Western blot analysis of lysates from Mouse kidney usingACSM3 Rabbit pAb (A25104) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.