MRPL50 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: MRPL50 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A25220
• Hersteller Artikelnummer: A25220
• Alternativnummer: ABB-A25220-20UL,ABB-A25220-100UL,ABB-A25220-500UL,ABB-A25220-1000UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: mL50, MRP-L50

Produktbeschreibung

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a putative 39S subunit protein and belongs to the L47P ribosomal protein family. Pseudogenes corresponding to this gene are found on chromosomes 2p, 2q, 5p, and 10q.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 18kDa
• NCBI: 54534
• UniProt: Q8N5N7
• Reinheit: Affinity purification
• Sequenz: MAARSVSGITRRVFMWTVSGTPCREFWSRFRKEKEPVVVETVEEKKEPILVCPPLRSRAYTPPEDLQSRLESYVKEVFGSSLPSNWQDISLEDSRLKFNL
• Target-Kategorie: MRPL50
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics and Nuclear Signaling, DNA / RNA, Translation, Ribosome. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from Hep G2 cells usingMRPL50 Rabbit pAb (A25220) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.