MRPL50 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: MRPL50 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25220
• Supplier Catalog Number: A25220
• Alternative Catalog Number: ABB-A25220-20UL,ABB-A25220-100UL,ABB-A25220-500UL,ABB-A25220-1000UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: mL50, MRP-L50

Product Description

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a putative 39S subunit protein and belongs to the L47P ribosomal protein family. Pseudogenes corresponding to this gene are found on chromosomes 2p, 2q, 5p, and 10q.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 18kDa
• NCBI: 54534
• UniProt: Q8N5N7
• Purity: Affinity purification
• Sequence: MAARSVSGITRRVFMWTVSGTPCREFWSRFRKEKEPVVVETVEEKKEPILVCPPLRSRAYTPPEDLQSRLESYVKEVFGSSLPSNWQDISLEDSRLKFNL
• Target: MRPL50
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics and Nuclear Signaling, DNA / RNA, Translation, Ribosome. Shipping: Ice Bag

Images

Western blot analysis of lysates from Hep G2 cells usingMRPL50 Rabbit pAb (A25220) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.