ZNF10 Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: ZNF10 Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: ABB-A25234
• Hersteller Artikelnummer: A25234
• Alternativnummer: ABB-A25234-20UL,ABB-A25234-100UL,ABB-A25234-1000UL,ABB-A25234-500UL
• Hersteller: ABclonal
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: ELISA, WB
• Spezies Reaktivität: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Konjugation: Unconjugated
• Alternative Synonym: KOX1, ZNF10

Produktbeschreibung

The protein encoded by this gene contains a C2H2 zinc finger, and has been shown to function as a transcriptional repressor. The Kruppel-associated box (KRAB) domain of this protein is found to be responsible for its transcriptional repression activity. RING finger containing protein TIF1 was reported to interact with the KRAB domain, and may serve as a mediator for the repression activity of this protein.

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 66kDa
• NCBI: 7556
• UniProt: P21506
• Reinheit: Affinity purification
• Sequenz: SALIVHQRIHTGEKPYECCQCGKAFIRKNDLIKHQRIHVGEETYKCNQCGIIFSQNSPFIVHQIAHTGEQFLTCNQCGTALVNTSNLIGYQTNHIRENAY
• Target-Kategorie: ZNF10
• Antibody Type: Primary Antibody

Anwendungsbeschreibung

• Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag

Bilder

Western blot analysis of lysates from wild type (WT) and293T cells transfected withZNF10 usingZNF10 Rabbit pAb (A25234) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:60s.