ZNF10 Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: ZNF10 Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: ABB-A25234
• Supplier Catalog Number: A25234
• Alternative Catalog Number: ABB-A25234-20UL,ABB-A25234-100UL,ABB-A25234-1000UL,ABB-A25234-500UL
• Manufacturer: ABclonal
• Host: Rabbit
• Category: Antikörper
• Application: ELISA, WB
• Species Reactivity: Human
• Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
• Conjugation: Unconjugated
• Alternative Names: KOX1, ZNF10

Product Description

The protein encoded by this gene contains a C2H2 zinc finger, and has been shown to function as a transcriptional repressor. The Kruppel-associated box (KRAB) domain of this protein is found to be responsible for its transcriptional repression activity. RING finger containing protein TIF1 was reported to interact with the KRAB domain, and may serve as a mediator for the repression activity of this protein.

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 66kDa
• NCBI: 7556
• UniProt: P21506
• Purity: Affinity purification
• Sequence: SALIVHQRIHTGEKPYECCQCGKAFIRKNDLIKHQRIHVGEETYKCNQCGIIFSQNSPFIVHQIAHTGEQFLTCNQCGTALVNTSNLIGYQTNHIRENAY
• Target: ZNF10
• Antibody Type: Primary Antibody

Application Notes

• Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
• Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag

Images

Western blot analysis of lysates from wild type (WT) and293T cells transfected withZNF10 usingZNF10 Rabbit pAb (A25234) at1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time:60s.